PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016459167.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GeBP
Protein Properties Length: 179aa    MW: 20719.7 Da    PI: 10.7121
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016459167.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57372.48.5e-23118178262
          DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLK 62 
                     +fqr+ws+eDei++L G++++++ ++ sps d +afy fvk++++++vsk+ql +K+++LK
  XP_016459167.1 118 NFQRIWSNEDEIAVLEGMLEYASARNISPSVDYNAFYIFVKDKLQVEVSKNQLKNKVKNLK 178
                     89**********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.5E-17119178IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MILVLKSSLR VKELPLRRRF FRREWKGSAG AENGVLRRSR EDLQPPEARS AVMYCGQRLW  60
ESERIWPKTT PIILLKESDK DWTPTSSKSI SSESHSNNRK KRTMKNSGKK GVSEAVNNFQ  120
RIWSNEDEIA VLEGMLEYAS ARNISPSVDY NAFYIFVKDK LQVEVSKNQL KNKVKNLKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016459167.11e-129PREDICTED: mediator-associated protein 1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30421947
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.12e-11DNA-binding storekeeper protein-related transcriptional regulator